PDB entry 5us8

View 5us8 on RCSB PDB site
Description: 2.15 Angstrom Resolution Crystal Structure of Argininosuccinate Synthase from Bordetella pertussis
Class: hydrolase,oxidoreductase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, Argininosuccinate Synthase, HYDROLASE, OXIDOREDUCTASE
Deposited on 2017-02-13, released 2017-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: argininosuccinate synthase
    Species: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) [TaxId:257313]
    Gene: argG, BP3537
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VTJ9 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5us8a1, d5us8a2, d5us8a3
  • Chain 'B':
    Compound: argininosuccinate synthase
    Species: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) [TaxId:257313]
    Gene: argG, BP3537
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7VTJ9 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5us8b1, d5us8b2, d5us8b3
  • Heterogens: EPE, PGE, ADN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5us8A (A:)
    snamttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeip
    rramqygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaa
    mkedgvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymr
    qagfdykmsaekaystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeev
    tvrfeegqpvalngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapgl
    allfiayerlvtgihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvarait
    gevtlelrrgndysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtr
    eklftyvktgllapsagsalpqikdgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5us8A (A:)
    snamttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeip
    rramqygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaa
    mkedgvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymr
    qagfdykmsaekaystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeev
    tvrfeegqpvalngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapgl
    allfiayerlvtgihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvarait
    gevtlelrrgndysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtr
    eklftyvktgllapsagsalpqikd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5us8B (B:)
    snamttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeip
    rramqygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaa
    mkedgvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymr
    qagfdykmsaekaystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeev
    tvrfeegqpvalngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapgl
    allfiayerlvtgihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvarait
    gevtlelrrgndysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtr
    eklftyvktgllapsagsalpqikdgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5us8B (B:)
    snamttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeip
    rramqygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaa
    mkedgvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymr
    qagfdykmsaekaystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeev
    tvrfeegqpvalngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapgl
    allfiayerlvtgihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvarait
    gevtlelrrgndysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtr
    eklftyvktgllapsagsalpqikd