SCOPe 2.06: Structural Classification of Proteins

PDB entry 5urr

View 5urr on RCSB PDB site
Description: Crystal Structure of the Catalytic Domain of the Inosine Monophosphate Dehydrogenase from Bacillus anthracis in the complex with IMP and the inhibitor P176
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: IMPDH, TIM barrel, delta CBS, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2017-02-12, released 2017-03-01
Made obsolete by 7mtx on 2021-06-09

The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: inosine-5'-monophosphate dehydrogenase
Species: Bacillus anthracis [TaxId:1392]
Gene: guaB, GBAA_0008, A8C77_00065, ABW01_29210
Database cross-references and differences (RAF-indexed):
- Uniprot Q81W29 (24-114)
  - expression tag (22-23)
  - linker (115-116)
- Uniprot Q81W29 (117-End)
Domains in SCOPe 2.06: d5urra1, d5urra2
Chain 'B':
Compound: inosine-5'-monophosphate dehydrogenase
Species: Bacillus anthracis [TaxId:1392]
Gene: guaB, GBAA_0008, A8C77_00065, ABW01_29210
Database cross-references and differences (RAF-indexed):
- Uniprot Q81W29 (24-114)
  - expression tag (22-23)
  - linker (115-116)
- Uniprot Q81W29 (117-End)
Domains in SCOPe 2.06: d5urrb1, d5urrb2
Chain 'C':
Compound: inosine-5'-monophosphate dehydrogenase
Species: Bacillus anthracis [TaxId:1392]
Gene: guaB, GBAA_0008, A8C77_00065, ABW01_29210
Database cross-references and differences (RAF-indexed):
- Uniprot Q81W29 (24-114)
  - expression tag (20-23)
  - linker (115-116)
- Uniprot Q81W29 (117-End)
Domains in SCOPe 2.06: d5urrc1, d5urrc2
Chain 'D':
Compound: inosine-5'-monophosphate dehydrogenase
Species: Bacillus anthracis [TaxId:1392]
Gene: guaB, GBAA_0008, A8C77_00065, ABW01_29210
Database cross-references and differences (RAF-indexed):
- Uniprot Q81W29 (24-114)
  - expression tag (21-23)
  - linker (115-116)
- Uniprot Q81W29 (117-End)
Domains in SCOPe 2.06: d5urrd1, d5urrd2
Chain 'E':
Compound: inosine-5'-monophosphate dehydrogenase
Species: Bacillus anthracis [TaxId:1392]
Gene: guaB, GBAA_0008, A8C77_00065, ABW01_29210
Database cross-references and differences (RAF-indexed):
- Uniprot Q81W29 (24-114)
  - expression tag (20-23)
  - linker (115-116)
- Uniprot Q81W29 (117-End)
Domains in SCOPe 2.06: d5urre1, d5urre2
Chain 'F':
Compound: inosine-5'-monophosphate dehydrogenase
Species: Bacillus anthracis [TaxId:1392]
Gene: guaB, GBAA_0008, A8C77_00065, ABW01_29210
Database cross-references and differences (RAF-indexed):
- Uniprot Q81W29 (24-114)
  - expression tag (19-23)
  - linker (115-116)
- Uniprot Q81W29 (117-End)
Domains in SCOPe 2.06: d5urrf1, d5urrf2
Chain 'G':
Compound: inosine-5'-monophosphate dehydrogenase
Species: Bacillus anthracis [TaxId:1392]
Gene: guaB, GBAA_0008, A8C77_00065, ABW01_29210
Database cross-references and differences (RAF-indexed):
- Uniprot Q81W29 (24-114)
  - expression tag (22-23)
  - linker (115-116)
- Uniprot Q81W29 (117-End)
Domains in SCOPe 2.06: d5urrg1, d5urrg2
Chain 'H':
Compound: inosine-5'-monophosphate dehydrogenase
Species: Bacillus anthracis [TaxId:1392]
Gene: guaB, GBAA_0008, A8C77_00065, ABW01_29210
Database cross-references and differences (RAF-indexed):
- Uniprot Q81W29 (24-114)
  - expression tag (22-23)
  - linker (115-116)
- Uniprot Q81W29 (117-End)
Domains in SCOPe 2.06: d5urrh1, d5urrh2
Heterogens: IMP, 8L7, K, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5urrA (A:)
mhhhhhhssgvdlgtenlyfqsnamweskfvkegltfddvllvpaksdvlprevsvktvl
seslqlniplisagmdtvteadmaiamarqgglgiihknmsieqqaeqvdkvkrsggllv
gaavgvtadamtridalvkasvdaivldtahghsqgvidkvkevrakypslniiagnvat
aeatkalieaganvvkvgigpgsicttrvvagvgvpqltavydcatearkhgipviadgg
ikysgdmvkalaagahvvmlgsmfagvaespgeteiyqgrqfkvyrgmgsvgamekgskd
ryfqegnkklvpegiegrvpykgpladtvhqlvgglragmgycgaqdleflrenaqfirm
sgaglleshphhvqitkeapnysl