PDB entry 5urn

View 5urn on RCSB PDB site
Description: NMR structure of the complex between the PH domain of the Tfb1 subunit from TFIIH and the transactivation domain 1 of p65
Class: transcription
Keywords: transcription factor tfiih, transactivation domain, nuclear factor kappa-b, transcriptional activation, p62/tfb1 subunit, transcription
Deposited on 2017-02-11, released 2017-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II transcription factor B subunit 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: TFB1, YDR311W, D9740.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32776 (1-114)
      • expression tag (0)
    Domains in SCOPe 2.08: d5urna1, d5urna2
  • Chain 'B':
    Compound: Transcription factor p65
    Species: Homo sapiens [TaxId:9606]
    Gene: Rela, Nfkb3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04206 (2-32)
      • expression tag (0-1)
      • engineered mutation (4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5urnA (A:)
pshsgaaifekvsgiiainedvspaeltwrstdgdkvhtvvlstidklqatpassekmml
rligkvdeskkrkdnegnevvpkpqrhmfsfnnrtvmdnikmtlqqiisrykdad

  • Chain 'B':
    No sequence available.