PDB entry 5ur7

View 5ur7 on RCSB PDB site
Description: Crystal structure of engineered CCL20 disulfide locked dimer
Class: immune system
Keywords: CCL20, chemokine, Macrophage Inflammatory Protein-3 alpha, MIP3-alpha, chemotaxis, psoriasis, locked dimer, cytokine, IMMUNE SYSTEM
Deposited on 2017-02-09, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-C motif chemokine 20
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL20, LARC, MIP3A, SCYA20
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78556 (Start-69)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5ur7a_
  • Chain 'B':
    Compound: C-C motif chemokine 20
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL20, LARC, MIP3A, SCYA20
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78556 (Start-69)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5ur7b_
  • Heterogens: ACT, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ur7A (A:)
    asnfdcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyiv
    rllckkvknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ur7A (A:)
    dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrllc
    kkvknm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ur7B (B:)
    asnfdcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyiv
    rllckkvknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ur7B (B:)
    dcclgytdrilhpkfivgftrqlanegcdinaiifhtkkklsvcanpkqtwvkyivrllc
    kkvknm