PDB entry 5uqr

View 5uqr on RCSB PDB site
Description: Crystal structure of 2-methylcitrate synthase from Aspergillus fumigatus
Class: transferase
Keywords: mcsA, 2-methylcitrate synthase, citrate synthase, ethyl-CoA, oxaloacetate, TRANSFERASE
Deposited on 2017-02-08, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata [TaxId:746128]
    Gene: mcsA, cit1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50I20 (4-440)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d5uqra1, d5uqra2
  • Chain 'B':
    Compound: 2-methylcitrate synthase, mitochondrial
    Species: Neosartorya fumigata [TaxId:746128]
    Gene: mcsA, cit1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uqrb_
  • Heterogens: OAA, NA, 8JD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uqrA (A:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqrA (A:)
    sgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvl
    dpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqs
    hlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisl
    lakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalh
    gdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtk
    ftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkkn
    seiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdr
    alglpierpksinllglkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uqrB (B:)
    sgsgstaepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegs
    vldpeegirfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelae
    qshlpqhildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsi
    sllakiprvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlyla
    lhgdheggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkig
    tkftdddvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvk
    knseiapavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliw
    dralglpierpksinllglkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uqrB (B:)
    aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee
    girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq
    hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki
    prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe
    ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd
    dvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia
    pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl
    pierpksinllglkk