PDB entry 5uq9

View 5uq9 on RCSB PDB site
Description: Crystal structure of 6-phosphogluconate dehydrogenase with ((4R,5R)-5-(hydroxycarbamoyl)-2,2-dimethyl-1,3-dioxolan-4-yl)methyl dihydrogen phosphate
Class: oxidoreductase
Keywords: Rossmann fold, Pentose phosphate pathway, Dehydrogenase, OXIDOREDUCTASE
Deposited on 2017-02-07, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Homo sapiens [TaxId:9606]
    Gene: PGD, PGDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq9a1, d5uq9a2
  • Chain 'B':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Homo sapiens [TaxId:9606]
    Gene: PGD, PGDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq9b1, d5uq9b2
  • Chain 'C':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Homo sapiens [TaxId:9606]
    Gene: PGD, PGDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq9c1, d5uq9c2
  • Chain 'D':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Homo sapiens [TaxId:9606]
    Gene: PGD, PGDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq9d1, d5uq9d2
  • Chain 'E':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Homo sapiens [TaxId:9606]
    Gene: PGD, PGDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq9e1, d5uq9e2
  • Chain 'F':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Homo sapiens [TaxId:9606]
    Gene: PGD, PGDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq9f1, d5uq9f2
  • Chain 'G':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Homo sapiens [TaxId:9606]
    Gene: PGD, PGDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq9g1, d5uq9g2
  • Chain 'H':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: Homo sapiens [TaxId:9606]
    Gene: PGD, PGDH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uq9h1, d5uq9h2
  • Heterogens: 8HS

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uq9A (A:)
    gamadimaqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvg
    aqslkemvsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcr
    dlkakgilfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwv
    gdegaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflie
    itanilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslk
    deriqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtln
    yggialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgv
    qagipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghgg
    tvssssyna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq9A (A:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
    vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
    lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdegagh
    fvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitanilk
    fqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagipmp
    cfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uq9B (B:)
    gamadimaqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvg
    aqslkemvsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcr
    dlkakgilfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwv
    gdegaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflie
    itanilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslk
    deriqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtln
    yggialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgv
    qagipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghgg
    tvssssyna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq9B (B:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
    vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
    lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdegagh
    fvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitanilk
    fqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagipmp
    cfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uq9C (C:)
    gamadimaqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvg
    aqslkemvsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcr
    dlkakgilfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwv
    gdegaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflie
    itanilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslk
    deriqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtln
    yggialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgv
    qagipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghgg
    tvssssyna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq9C (C:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
    vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
    lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdegagh
    fvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitanilk
    fqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagipmp
    cfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uq9D (D:)
    gamadimaqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvg
    aqslkemvsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcr
    dlkakgilfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwv
    gdegaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflie
    itanilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslk
    deriqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtln
    yggialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgv
    qagipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghgg
    tvssssyna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq9D (D:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
    vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
    lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdegagh
    fvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitanilk
    fqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagipmp
    cfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5uq9E (E:)
    gamadimaqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvg
    aqslkemvsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcr
    dlkakgilfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwv
    gdegaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflie
    itanilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslk
    deriqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtln
    yggialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgv
    qagipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghgg
    tvssssyna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq9E (E:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
    vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
    lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdegagh
    fvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitanilk
    fqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagipmp
    cfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5uq9F (F:)
    gamadimaqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvg
    aqslkemvsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcr
    dlkakgilfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwv
    gdegaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflie
    itanilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslk
    deriqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtln
    yggialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgv
    qagipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghgg
    tvssssyna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq9F (F:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
    vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
    lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdegagh
    fvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitanilk
    fqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagipmp
    cfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5uq9G (G:)
    gamadimaqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvg
    aqslkemvsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcr
    dlkakgilfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwv
    gdegaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflie
    itanilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslk
    deriqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtln
    yggialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgv
    qagipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghgg
    tvssssyna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq9G (G:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
    vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
    lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdegagh
    fvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitanilk
    fqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagipmp
    cfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfiht
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5uq9H (H:)
    gamadimaqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvg
    aqslkemvsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcr
    dlkakgilfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwv
    gdegaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflie
    itanilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslk
    deriqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtln
    yggialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgv
    qagipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwtghgg
    tvssssyna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uq9H (H:)
    aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
    vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
    lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgdegagh
    fvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieitanilk
    fqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkderiqas
    kklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggialm
    wrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagipmp
    cfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfiht