PDB entry 5upr

View 5upr on RCSB PDB site
Description: X-ray structure of a putative triosephosphate isomerase from Toxoplasma gondii ME49
Class: isomerase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, ISOMERASE
Deposited on 2017-02-03, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Toxoplasma gondii (strain ATCC 50611 / Me49) [TaxId:508771]
    Gene: TPI-II, TGME49_233500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5upra_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Toxoplasma gondii (strain ATCC 50611 / Me49) [TaxId:508771]
    Gene: TPI-II, TGME49_233500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uprb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: Toxoplasma gondii (strain ATCC 50611 / Me49) [TaxId:508771]
    Gene: TPI-II, TGME49_233500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uprc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: Toxoplasma gondii (strain ATCC 50611 / Me49) [TaxId:508771]
    Gene: TPI-II, TGME49_233500
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uprd_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uprA (A:)
    asalwaarrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdsl
    rqprvqvaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvv
    akkvraalneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayep
    vwaigtgktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedv
    dgflvggasltgdfvsiidaakqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uprA (A:)
    alwaarrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdslrq
    prvqvaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvvak
    kvraalneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayepvw
    aigtgktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedvdg
    flvggasltgdfvsiidaakqqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uprB (B:)
    asalwaarrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdsl
    rqprvqvaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvv
    akkvraalneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayep
    vwaigtgktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedv
    dgflvggasltgdfvsiidaakqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uprB (B:)
    alwaarrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdslrp
    rvqvaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvvakk
    vraalneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayepvwa
    igtgktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedvdgf
    lvggasltgdfvsiidaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5uprC (C:)
    asalwaarrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdsl
    rqprvqvaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvv
    akkvraalneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayep
    vwaigtgktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedv
    dgflvggasltgdfvsiidaakqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uprC (C:)
    rrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdslrqprvqv
    aaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvvakkvraa
    lneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayepvwaigtg
    ktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedvdgflvgg
    asltgdfvsiidaakq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5uprD (D:)
    asalwaarrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdsl
    rqprvqvaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvv
    akkvraalneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayep
    vwaigtgktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedv
    dgflvggasltgdfvsiidaakqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uprD (D:)
    arrgfvggnwkcngttaktqelvdmlnsapvsfeqvdvvvappslfisqvqdslrqprvq
    vaaqdsstqqaygaftgelspkmikeknipwvvlghserragfggqpgesnqvvakkvra
    alneglsvilcigetleeresgqtqkvlseqleavrqavpeadawksiviayepvwaigt
    gktataalaqethrdirnwlaqavspkvaeatrviyggsvkgsnakelfegedvdgflvg
    gasltgdfvsiidaak