PDB entry 5up9

View 5up9 on RCSB PDB site
Description: Crystal Structure of Zn-bound Human Heavy-Chain ferritin variant 122H-delta C-star with para-xylenedihydroxamate
Class: oxidoreductase
Keywords: oxidoreductase self-assembly Protein-MOF Protein-Metal-Organic Framework, OXIDOREDUCTASE
Deposited on 2017-02-01, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (85)
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (121)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5up9a_
  • Chain 'B':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (85)
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (121)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5up9b_
  • Chain 'C':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (85)
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (121)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5up9c_
  • Chain 'D':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (85)
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (121)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5up9d_
  • Chain 'E':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (85)
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (121)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5up9e_
  • Chain 'F':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (85)
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (121)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5up9f_
  • Heterogens: ZN, PGE, PEG, BYX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5up9A (A:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhkl
    ahdkndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5up9A (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahdk
    ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5up9B (B:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhkl
    ahdkndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5up9B (B:)
    stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahd
    kndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5up9C (C:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhkl
    ahdkndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5up9C (C:)
    stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahd
    kndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5up9D (D:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhkl
    ahdkndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5up9D (D:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahdk
    ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5up9E (E:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhkl
    ahdkndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5up9E (E:)
    stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahd
    kndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5up9F (F:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhkl
    ahdkndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5up9F (F:)
    stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahd
    kndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgd