PDB entry 5uoo

View 5uoo on RCSB PDB site
Description: BRD4 bromodomain 2 in complex with CD161
Class: transcription
Keywords: Bromodomain, transcription
Deposited on 2017-02-01, released 2017-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5uooa_
  • Heterogens: 8FV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5uooA (A:)
snakdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhd
ycdiikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdv
femrfakmpde

    Sequence, based on observed residues (ATOM records): (download) 
    >5uooA (A:)
skvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskl
eareyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpde