PDB entry 5umg

View 5umg on RCSB PDB site
Description: Crystal structure of dihydropteroate synthase from Klebsiella pneumoniae subsp.
Class: transferase
Keywords: Structural Genomics, CSGID, Center for Structural Genomics of Infectious Diseases, dihydropteroate synthase, TRANSFERASE
Deposited on 2017-01-27, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) [TaxId:272620]
    Gene: folP, KPN_03587
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5umga_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) [TaxId:272620]
    Gene: folP, KPN_03587
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5umgb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5umgA (A:)
    mklvaqgstldlshphvmgilnvtpdsfsdggahnslieavkhanlminagatiidigge
    strpgaaevsveeelarvipvveaiaqrfevwisvdtskaevirqsaragahiindirsl
    tepgalqaaaetglpvclmhmqgqpktmqeapkyedvfadverffnehivrceqagiake
    kllldpgfgfgknlshnyqllarlgefhhfglpllvgmsrksmvgqllnvgpserlngsl
    acaviaamqgaqiirvhdvketvealrvveatlaakgkkrye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5umgA (A:)
    mklvaqgstldlshphvmgilnvslieavkhanlminagatiidiggeevsveeelarvi
    pvveaiaqrfevwisvdtskaevirqsaragahiindirsltepgalqaaaetglpvclm
    hmqgqppkyedvfadverffnehivrceqagiakekllldpgfgfgknlshnyqllarlg
    efhhfglpllvgmsrksmvgqllnvgpserlngslacaviaamqgaqiirvhdvketvea
    lrvveatlaakgkrye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5umgB (B:)
    mklvaqgstldlshphvmgilnvtpdsfsdggahnslieavkhanlminagatiidigge
    strpgaaevsveeelarvipvveaiaqrfevwisvdtskaevirqsaragahiindirsl
    tepgalqaaaetglpvclmhmqgqpktmqeapkyedvfadverffnehivrceqagiake
    kllldpgfgfgknlshnyqllarlgefhhfglpllvgmsrksmvgqllnvgpserlngsl
    acaviaamqgaqiirvhdvketvealrvveatlaakgkkrye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5umgB (B:)
    mklvaqgstldlshphvmgilnvthnslieavkhanlminagatiidiggeevsveeela
    rvipvveaiaqrfevwisvdtskaevirqsaragahiindirsltepgalqaaaetglpv
    clmhmqkyedvfadverffnehivrceqagiakekllldpgfgfgknlshnyqllarlge
    fhhfglpllvgmsrksmvgqllnvgpserlngslacaviaamqgaqiirvhdvketveal
    rvveatlaakgkkrye