PDB entry 5ume

View 5ume on RCSB PDB site
Description: Crystal Structure of 5,10-Methylenetetrahydrofolate Reductase MetF from Haemophilus influenzae
Class: oxidoreductase
Keywords: alpha-beta structure, TIM barrel, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2017-01-27, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-Methylenetetrahydrofolate reductase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: metF, HI_1444
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5umea_
  • Chain 'B':
    Compound: 5,10-Methylenetetrahydrofolate reductase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: metF, HI_1444
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5umeb_
  • Chain 'C':
    Compound: 5,10-Methylenetetrahydrofolate reductase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: metF, HI_1444
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5umec_
  • Chain 'D':
    Compound: 5,10-Methylenetetrahydrofolate reductase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: metF, HI_1444
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5umed_
  • Chain 'E':
    Compound: 5,10-Methylenetetrahydrofolate reductase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: metF, HI_1444
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45208 (3-294)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5umee1, d5umee2
  • Chain 'F':
    Compound: 5,10-Methylenetetrahydrofolate reductase
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: metF, HI_1444
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5umef_
  • Heterogens: FAD, SO4, ACY, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5umeA (A:)
    snamsyakeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvt
    ygansgerdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrg
    depkgyakkpfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganh
    vitqfffdienylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkay
    dgldndpttrnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5umeA (A:)
    yakeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvtygans
    gerdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrgdepkp
    fyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganhvitqfffdie
    nylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkaydgldndpttr
    nlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5umeB (B:)
    snamsyakeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvt
    ygansgerdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrg
    depkgyakkpfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganh
    vitqfffdienylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkay
    dgldndpttrnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5umeB (B:)
    kinvsfeffppknekmetllwdsihrlkvlkpkfvsvtysgerdrthgivkaikqetgle
    aaphltgidatpeelkqiardywdsgirrivalrgdpfyasdlvellrsvadfdisvaay
    pevhpeaksaqadlinlkrkidaganhvitqfffdienylrfrdrcasigidteivpgil
    pvtnfkqlqkmasftnvkipawlvkaydgldndpttrnlvaasvamdmvkilsregvndf
    hfytlnrseltyaichmlgvrp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5umeC (C:)
    snamsyakeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvt
    ygansgerdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrg
    depkgyakkpfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganh
    vitqfffdienylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkay
    dgldndpttrnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5umeC (C:)
    akeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvtygansg
    erdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrgdepakk
    pfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganhvitqfffdi
    enylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkaydgldndptt
    rnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5umeD (D:)
    snamsyakeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvt
    ygansgerdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrg
    depkgyakkpfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganh
    vitqfffdienylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkay
    dgldndpttrnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5umeD (D:)
    syakeidtlnqhiankkinvsfeffppknekmetllwdsihrlkvlkpkfvsvtygansg
    erdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrgdepkgy
    akkpfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganhvitqff
    fdienylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkaydgldnd
    pttrnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5umeE (E:)
    snamsyakeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvt
    ygansgerdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrg
    depkgyakkpfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganh
    vitqfffdienylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkay
    dgldndpttrnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5umeE (E:)
    namsyakeidtlnqhiadkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvtyga
    nsgerdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrgdep
    kgyakkpfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganhvit
    qfffdienylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkaydgl
    dndpttrnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5umeF (F:)
    snamsyakeidtlnqhiadfnkkinvsfeffppknekmetllwdsihrlkvlkpkfvsvt
    ygansgerdrthgivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrg
    depkgyakkpfyasdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganh
    vitqfffdienylrfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkay
    dgldndpttrnlvaasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5umeF (F:)
    idtlnqhiakinvsfeffppknekmetllwdsihrlkvlkpkfvsvtygansgerdrthg
    ivkaikqetgleaaphltgidatpeelkqiardywdsgirrivalrgdepkgyakkpfya
    sdlvellrsvadfdisvaaypevhpeaksaqadlinlkrkidaganhvitqfffdienyl
    rfrdrcasigidteivpgilpvtnfkqlqkmasftnvkipawlvkaydgldndpttrnlv
    aasvamdmvkilsregvndfhfytlnrseltyaichmlgvrp