PDB entry 5ull

View 5ull on RCSB PDB site
Description: clostridium beijerinckii flavodoxin: reduced
Class: electron transport
Keywords: electron transport, flavoprotein, fmn
Deposited on 1997-01-09, released 1997-03-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Clostridium beijerinckii [TaxId:1520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d5ulla_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ullA (A:)
    mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgdev
    leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
    pdeaeqdciefgkkiani