PDB entry 5ull

View 5ull on RCSB PDB site
Description: clostridium beijerinckii flavodoxin: reduced
Deposited on 1997-01-09, released 1997-03-12
The last revision prior to the SCOP 1.59 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d5ull__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ull_ (-)
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgdev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiani