PDB entry 5ul5

View 5ul5 on RCSB PDB site
Description: Crystal structure of RPE65 in complex with MB-004 and palmitate
Class: isomerase/isomerase inhibitor
Keywords: retinoid isomerase, non-heme iron enzyme, inhibitor, ISOMERASE, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2017-01-24, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoid isomerohydrolase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28175 (0-532)
      • see remark 999 (340)
    Domains in SCOPe 2.07: d5ul5a_
  • Chain 'B':
    Compound: Retinoid isomerohydrolase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q28175 (0-532)
      • see remark 999 (340)
    Domains in SCOPe 2.07: d5ul5b_
  • Heterogens: FE2, PLM, 8D7, NA, PG6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ul5A (A:)
    mssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhl
    fdgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrff
    syfrgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatah
    phiendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyv
    hsfgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyi
    nnkyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarka
    pqpevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpq
    inyqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdale
    eddgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ul5A (A:)
    mssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhl
    fdgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafvevtdnalvniy
    pvgedyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfi
    aynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvkinlf
    kflsswslwganymdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintyedhe
    flivdlccwkgfefvynylylanlrenweevkknarkapqpevrryvlplnidkadtgkn
    lvtlpnttatailcsdetiwlepevlfsgprqafefpqinyqkyggkpytyayglglnhf
    vpdrlcklnvktketwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkpayl
    lilnakdlsevaraeveinipvtfhglfkks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ul5B (B:)
    mssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhl
    fdgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrff
    syfrgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatah
    phiendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyv
    hsfgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyi
    nnkyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarka
    pqpevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpq
    inyqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdale
    eddgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ul5B (B:)
    mssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhl
    fdgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpgvevtdnalvn
    iypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynignc
    fiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvkin
    lfkflsswslwganymdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintyed
    heflivdlccwkgfefvynylylanlrenweevkknarkapqpevrryvlplnidkadtg
    knlvtlpnttatailcsdetiwlepevlfsgprqafefpqinyqkyggkpytyayglgln
    hfvpdrlcklnvktketwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkpa
    yllilnakdlsevaraeveinipvtfhglfkks