PDB entry 5uj5

View 5uj5 on RCSB PDB site
Description: Solution structure of the oxidized iron-sulfur protein adrenodoxin from Encephalitozoon cuniculi. Seattle Structural Genomics Center for Infectious Disease target EncuA.00705.a
Class: electron transport
Keywords: infectious diseases, microsporidosis, SSGCID, iron-sulfur protein, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, ELECTRON TRANSPORT
Deposited on 2017-01-17, released 2017-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adrenodoxin
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Gene: ECU07_0600
    Database cross-references and differences (RAF-indexed):
    • Uniprot M1JK92 (4-131)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d5uj5a1, d5uj5a2
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5uj5A (A:)
    gpgsmdmfsapdripeqiriffktmkqvvpakavcgstvldvahkngvdlegacegnlac
    stchvileeplyrklgepsdkeydlidqafgatgtsrlgcqlrvdksfenavftvpratk
    nmavdgfkpkph