PDB entry 5ui4

View 5ui4 on RCSB PDB site
Description: Structure of NME1 covalently conjugated to imidazole fluorosulfate
Class: transferase
Keywords: arylfluorosulfate, covalent, kinase, TRANSFERASE
Deposited on 2017-01-12, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ui4a_
  • Chain 'B':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ui4b_
  • Chain 'C':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ui4c_
  • Chain 'D':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ui4d_
  • Chain 'E':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ui4e_
  • Chain 'F':
    Compound: Nucleoside Diphosphate Kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: NME1, NDPKA, NM23
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ui4f_
  • Heterogens: A7Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ui4A (A:)
    mhhhhhhmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyv
    dlkdrpffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvg
    rniihgsdsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ui4A (A:)
    ncertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffa
    glvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsds
    vesaekeiglwfhpeelvdytscaqnwiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ui4B (B:)
    mhhhhhhmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyv
    dlkdrpffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvg
    rniihgsdsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ui4B (B:)
    ncertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffa
    glvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsds
    vesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ui4C (C:)
    mhhhhhhmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyv
    dlkdrpffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvg
    rniihgsdsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ui4C (C:)
    ncertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffa
    glvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsds
    vesaekeiglwfhpeelvdytscaqnwiy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ui4D (D:)
    mhhhhhhmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyv
    dlkdrpffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvg
    rniihgsdsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ui4D (D:)
    ncertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffa
    glvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsds
    vesaekeiglwfhpeelvdytscaqnwiye
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ui4E (E:)
    mhhhhhhmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyv
    dlkdrpffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvg
    rniihgsdsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ui4E (E:)
    ncertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffa
    glvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsds
    vesaekeiglwfhpeelvdytscaqnwiy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ui4F (F:)
    mhhhhhhmancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyv
    dlkdrpffaglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvg
    rniihgsdsvesaekeiglwfhpeelvdytscaqnwiye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ui4F (F:)
    ncertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpffa
    glvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsds
    vesaekeiglwfhpeelvdytscaqnwiy