PDB entry 5ui2

View 5ui2 on RCSB PDB site
Description: crystal structure of orange carotenoid protein
Class: carotenoid binding protein
Keywords: carotenoid binding protein
Deposited on 2017-01-12, released 2017-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Orange carotenoid-binding protein
    Species: Arthrospira maxima [TaxId:129910]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ui2a1, d5ui2a2
  • Chain 'B':
    Compound: Orange carotenoid-binding protein
    Species: Arthrospira maxima [TaxId:129910]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ui2b1, d5ui2b2
  • Heterogens: SUC, CL, EQ3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ui2A (A:)
    mpftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaan
    mqfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqg
    lvapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvp
    pqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentl
    rffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkv
    ffvaidllaspkellnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ui2A (A:)
    pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
    qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
    vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvpp
    qemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentlr
    ffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkvf
    fvaidllaspkellnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ui2B (B:)
    mpftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaan
    mqfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqg
    lvapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvp
    pqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentl
    rffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkv
    ffvaidllaspkellnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ui2B (B:)
    pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
    qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
    vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvpp
    qemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentlr
    ffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkvf
    fvaidllaspkell