PDB entry 5ui2

View 5ui2 on RCSB PDB site
Description: crystal structure of orange carotenoid protein
Deposited on 2017-01-12, released 2017-01-25
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Orange carotenoid-binding protein
    Species: Arthrospira maxima [TaxId:129910]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Orange carotenoid-binding protein
    Species: Arthrospira maxima [TaxId:129910]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, EQ3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.05, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ui2A (A:)
    mpftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaan
    mqfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqg
    lvapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvp
    pqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentl
    rffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkv
    ffvaidllaspkellnl
    

    Sequence, based on observed residues (ATOM records):
    >5ui2A (A:)
    pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
    qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
    vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvpp
    qemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentlr
    ffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkvf
    fvaidllaspkellnl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ui2B (B:)
    mpftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaan
    mqfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqg
    lvapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvp
    pqemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentl
    rffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkv
    ffvaidllaspkellnl
    

    Sequence, based on observed residues (ATOM records):
    >5ui2B (B:)
    pftidtarsifpetlaadvvpatiarfkqlsaedqlaliwfaylemgktitiaapgaanm
    qfaentlqeirqmtplqqtqamcdlanrtdtpicrtyaswspniklgfwyelgrfmdqgl
    vapipegyklsananailvtiqgidpgqqitvlrncvvdmgfdtsklgsyqrvaepvvpp
    qemsqrtkvqiegvtnstvlqymdnlnandfdnlislfaedgalqppfqkpivgkentlr
    ffreecqnlklipergvseptedgytqikvtgkvqtpwfggnvgmniawrfllnpenkvf
    fvaidllaspkell