PDB entry 5uhv

View 5uhv on RCSB PDB site
Description: wild-type NRas bound to GppNHp
Class: hydrolase
Keywords: NRas, GTPase, HYDROLASE
Deposited on 2017-01-12, released 2017-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase NRas
    Species: Homo sapiens [TaxId:9606]
    Gene: NRAS, HRAS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uhva_
  • Heterogens: GNP, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5uhvA (A:)
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainnsksfadinlyreqikrvkdsddvpmvlvgnkcdl
ptrtvdtkqahelaksygipfietsaktrqgvedafytlvreirqy