PDB entry 5ugy

View 5ugy on RCSB PDB site
Description: Influenza hemagglutinin in complex with a neutralizing antibody
Class: viral protein/immune system
Keywords: influenza hemagglutinin, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2017-01-10, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UPX0 (1-322)
      • expression tag (0)
    Domains in SCOPe 2.07: d5ugya1, d5ugya2
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ugyb_
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UPX0 (1-322)
      • expression tag (0)
    Domains in SCOPe 2.07: d5ugyc1, d5ugyc2
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ugyd_
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UPX0 (1-322)
      • expression tag (0)
    Domains in SCOPe 2.07: d5ugye1, d5ugye2
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ugyf_
  • Chain 'H':
    Compound: CH65 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5UGY (0-120)
    • Uniprot S6C4S0 (121-226)
  • Chain 'I':
    Compound: CH65 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5UGY (0-120)
    • Uniprot S6C4S0 (121-226)
  • Chain 'J':
    Compound: CH65 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5UGY (0-120)
    • Uniprot S6C4S0 (121-226)
  • Chain 'L':
    Compound: CH65 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGL@
    Database cross-references and differences (RAF-indexed):
    • PDB 5UGY (0-96)
    • Uniprot Q8N355 (97-209)
    Domains in SCOPe 2.07: d5ugyl1, d5ugyl2
  • Chain 'M':
    Compound: CH65 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGL@
    Database cross-references and differences (RAF-indexed):
    • PDB 5UGY (0-96)
    • Uniprot Q8N355 (97-209)
    Domains in SCOPe 2.07: d5ugym1, d5ugym2
  • Chain 'N':
    Compound: CH65 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGL@
    Database cross-references and differences (RAF-indexed):
    • PDB 5UGY (0-96)
    • Uniprot Q8N355 (97-209)
    Domains in SCOPe 2.07: d5ugyn1, d5ugyn2
  • Heterogens: NAG, BMA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ugyA (A:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnips
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ugyB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ugyC (C:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnips
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ugyD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ugyE (E:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvag
    wilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpk
    esswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvh
    hppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepgdti
    ifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvti
    gecpkyvrsaklrmvtglrnips
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ugyF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ugyL (L:)
    svltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ugyM (M:)
    svltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ugyN (N:)
    svltqppsvsvapgqtaritcggndigrksvhwnqqkpgqapvlvvcydsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsssdhvifgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt