PDB entry 5ugb

View 5ugb on RCSB PDB site
Description: Crystal structure of the EGFR kinase domain in complex with 4-(4-{[2-{[(3S)-1-acetylpyrrolidin-3-yl]amino}-9-(propan-2-yl)-9H-purin-6-yl]amino}phenyl)-1-methylpiperazin-1-ium
Class: transferase/transferase inhibitor
Keywords: Kinase, covalent inhibitor, lung cancer, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-01-07, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ugba_
  • Heterogens: 8BM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ugbA (A:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ugbA (A:)
    sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelatspkan
    keildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
    pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
    pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpdmddvv
    dadeyli