PDB entry 5ufx

View 5ufx on RCSB PDB site
Description: Estrogen Receptor Alpha Ligand Binding Domain in Complex with OP1074
Class: transcription
Keywords: Breast Cancer, Estrogen, Steroid, Acquired Resistance, TRANSCRIPTION
Deposited on 2017-01-06, released 2018-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-10, with a file datestamp of 2018-01-05.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (75)
      • engineered mutation (111)
      • engineered mutation (224)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d5ufxa_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-End)
      • engineered mutation (75)
      • engineered mutation (111)
      • engineered mutation (224)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d5ufxb_
  • Heterogens: 86Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ufxA (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld
    ahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ufxA (A:)
    sltadqmvsalldaeppilyseydppfseasmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmlla
    tssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemldah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ufxB (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld
    ahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ufxB (B:)
    lalsltadqmvsalldaeppilyseydptrpfsmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytleekdhihrvldkitdtlihlmakaglt
    lqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemldah