PDB entry 5ufw

View 5ufw on RCSB PDB site
Description: Estrogen Receptor Alpha Ligand Binding Domain in Complex with OP1154
Class: transcription
Keywords: Estrogen, Breast Cancer, Hormone, Nuclear Hormone Receptor, TRANSCRIPTION
Deposited on 2017-01-06, released 2018-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-10, with a file datestamp of 2018-01-05.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (75)
      • engineered mutation (111)
      • engineered mutation (224)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d5ufwa_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-End)
      • engineered mutation (75)
      • engineered mutation (111)
      • engineered mutation (224)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d5ufwb_
  • Heterogens: 86V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ufwA (A:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld
    ahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ufwA (A:)
    sltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlma
    kagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ufwB (B:)
    lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
    gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
    dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
    lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld
    ahrlhapts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ufwB (B:)
    lalsltadqmvsalldaeppilyseydptrpfsmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvyteekdhihrvldkitdtlihlmakagltl
    qqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemlda