PDB entry 5ue7

View 5ue7 on RCSB PDB site
Description: Crystal structure of the phosphomannomutase PMM1 from Candida albicans, apoenzyme state
Class: isomerase
Keywords: phosphomannomutase, isomerase, mannose-6-phosphate, mannose-1-phosphate, HAD domain, structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, National Institute of Allergy and Infectious Diseases, NIAID
Deposited on 2016-12-29, released 2017-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphomannomutase
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: PMM1, CaO19.10454, CaO19.2937
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ue7a_
  • Chain 'B':
    Compound: Phosphomannomutase
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: PMM1, CaO19.10454, CaO19.2937
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ue7b_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ue7A (A:)
    msfankqdpktlvlfdvdgtltparltiseemkktleklrekvvigfvggsdlskqveql
    gpnvlndfdycfsengltayklgkelasqsfinwignekynklvkfilrylsdidlpirr
    gtfiefrngminvspigrnastqerndyekfdkqhhiretmvealkkefpdfgltysigg
    qisfdvfptgwdktyclqhvedehfenihffgdksykggndyeiyndprtighavnspdd
    tirilnetfklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ue7A (A:)
    sfankqdpktlvlfdvdgtltparltiseemkktleklrekvvigfvggsdlskqveqlg
    pnvlndfdycfsengltayklgkelasqsfinwignekynklvkfilrylsdidlpirrg
    tfiefrngminvspigrnastqerndyekfdkqhhiretmvealkkefpdfgltysiggq
    isfdvfptgwdktyclqhvedehfenihffgdksykggndyeiyndprtighavnspddt
    irilnetfklq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ue7B (B:)
    msfankqdpktlvlfdvdgtltparltiseemkktleklrekvvigfvggsdlskqveql
    gpnvlndfdycfsengltayklgkelasqsfinwignekynklvkfilrylsdidlpirr
    gtfiefrngminvspigrnastqerndyekfdkqhhiretmvealkkefpdfgltysigg
    qisfdvfptgwdktyclqhvedehfenihffgdksykggndyeiyndprtighavnspdd
    tirilnetfklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ue7B (B:)
    sfankqdpktlvlfdvdgtltparltiseemkktleklrekvvigfvggsdlskqveqlg
    pnvlndfdycfsengltayklgkelasqsfinwignekynklvkfilrylsdidlpirrg
    tfiefrngminvspigrnastqerndyekfdkqhhiretmvealkkefpdfgltysiggq
    isfdvfptgwdktyclqhvedehfenihffgdksykggndyeiyndprtighavnspddt
    irilnetfklq