PDB entry 5ucz

View 5ucz on RCSB PDB site
Description: Class II fructose-1,6-bisphosphate aldolase E149A variant of Helicobacter pylori with DHAP
Class: lyase
Keywords: Glycolysis, Metalloenzyme, LYASE
Deposited on 2016-12-23, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: fba, HP_0176
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56109 (0-306)
      • conflict (47)
      • conflict (66)
    Domains in SCOPe 2.07: d5ucza_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: fba, HP_0176
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56109 (0-306)
      • conflict (47)
      • conflict (66)
    Domains in SCOPe 2.07: d5uczb_
  • Heterogens: NA, ZN, 13P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uczA (A:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgrlmgiednisvdakdavlvnpkeaeqfvkesqvdylapaigtsh
    gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
    lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
    lgsanki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uczA (A:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelglvnpkeaeqfvkesqvdylapaigtshgafkfkgepkldferlq
    evkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvntdtd
    lriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uczB (B:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgrlmgiednisvdakdavlvnpkeaeqfvkesqvdylapaigtsh
    gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
    lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
    lgsanki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uczB (B:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgvlvnpkeaeqfvkesqvdylapaigtshgafkfkgepkldferl
    qevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvntdt
    dlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki