PDB entry 5ucr

View 5ucr on RCSB PDB site
Description: Crystal Structure of a Pantoate-beta-alanine Ligase from Neisseria gonorrhoeae with bound AMPPNP and Alanine
Class: ligase
Keywords: SSGCID, pantoate-beta-alanine_ligase, AMPPNP, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LIGASE
Deposited on 2016-12-22, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate synthetase
    Species: Neisseria gonorrhoeae [TaxId:521006]
    Gene: panC, NGK_0607
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4RKE7 (27-284)
      • expression tag (6-26)
      • engineered mutation (219)
    Domains in SCOPe 2.07: d5ucra1, d5ucra2
  • Chain 'B':
    Compound: Pantothenate synthetase
    Species: Neisseria gonorrhoeae [TaxId:521006]
    Gene: panC, NGK_0607
    Database cross-references and differences (RAF-indexed):
    • Uniprot B4RKE7 (27-End)
      • expression tag (6-26)
      • engineered mutation (219)
    Domains in SCOPe 2.07: d5ucrb1, d5ucrb2
  • Heterogens: ANP, ALA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ucrA (A:)
    ahhhhhhmqiihtirelrtwrentgkvafvptmgnlheghlalvrearkradnvvvsifv
    nrlqfgqgedfdkyprtlqqdadklaaegvavvfapdekelypnveqrynvepphlqnel
    cgkfrpghfrgvatvvsklfnivlpdvacfgkkdyqqlavikgltedlnfdieivpvdtg
    raadglalssrnrylsvgeraeaprlyrelqavaeslkqggldyaglerqaadhltaagw
    lvdyveirradtlemaragdkklvvlaaarlgttrlidnvevglp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ucrA (A:)
    hmqiihtirelrtwrentgkvafvptmgnlheghlalvrearkradnvvvsifvnrlqfg
    qrtlqqdadklaaegvavvfapdekelypnveqrynvepphlqnelcgkfrpghfrgvat
    vvsklfnivlpdvacfgkkdyqqlavikgltedlnfdieivpvdtgraadglalssrnry
    lsvgeraeaprlyrelqavaeslkqggldyaglerqaadhltaagwlvdyveirradtle
    maragdkklvvlaaarlgttrlidnvevglp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ucrB (B:)
    ahhhhhhmqiihtirelrtwrentgkvafvptmgnlheghlalvrearkradnvvvsifv
    nrlqfgqgedfdkyprtlqqdadklaaegvavvfapdekelypnveqrynvepphlqnel
    cgkfrpghfrgvatvvsklfnivlpdvacfgkkdyqqlavikgltedlnfdieivpvdtg
    raadglalssrnrylsvgeraeaprlyrelqavaeslkqggldyaglerqaadhltaagw
    lvdyveirradtlemaragdkklvvlaaarlgttrlidnvevglp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ucrB (B:)
    hmqiihtirelrtwrentgkvafvptmgnlheghlalvrearkradnvvvsifvnrlqpr
    tlqqdadklaaegvavvfapdekelypnveqrynvepphlqnelcgkfrpghfrgvatvv
    sklfnivlpdvacfgkkdyqqlavikgltedlnfdieivpvdtgraadglalssrnryls
    vgeraeaprlyrelqavaeslkqggldyaglerqaadhltaagwlvdyveirradtlema
    ragdkklvvlaaarlgttrlidnvev