PDB entry 5ucq

View 5ucq on RCSB PDB site
Description: The structure of archaeal Inorganic Pyrophosphatase in complex with pyrophosphate
Class: hydrolase
Keywords: Hydrolase, thermophile
Deposited on 2016-12-22, released 2017-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ucqa_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ucqb_
  • Chain 'C':
    Compound: inorganic pyrophosphatase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: PPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ucqc_
  • Heterogens: CA, EDO, MRD, POP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ucqA (A:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ucqA (A:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ucqB (B:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ucqB (B:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ucqC (C:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfgkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ucqC (C:)
    mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
    qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
    disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg