PDB entry 5ucp

View 5ucp on RCSB PDB site
Description: Class II fructose-1,6-bisphosphate aldolase E142A variant of Helicobacter pylori with FBP and cleavage products
Class: lyase
Keywords: Glycolysis, Metalloenzyme, LYASE
Deposited on 2016-12-22, released 2018-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: fba, HP_0176
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56109 (0-306)
      • conflict (47)
      • conflict (66)
    Domains in SCOPe 2.08: d5ucpa_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase
    Species: Helicobacter pylori (strain ATCC 700392 / 26695) [TaxId:85962]
    Gene: fba, HP_0176
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56109 (0-306)
      • conflict (47)
      • conflict (66)
    Domains in SCOPe 2.08: d5ucpb_
  • Heterogens: NA, ZN, P6F, 13P, G3H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ucpA (A:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgrlmgiadnisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
    gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
    lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
    lgsanki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ucpA (A:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgrvlvnpkeaeqfvkesqvdylapaigtshgafkfkgepkldfer
    lqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvntd
    tdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ucpB (B:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgrlmgiadnisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
    gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
    lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
    lgsanki
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ucpB (B:)
    mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
    avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
    vkmahnagvsveaelgravlvnpkeaeqfvkesqvdylapaigtshgafkfkgepkldfe
    rlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkvnt
    dtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki