PDB entry 5uc5

View 5uc5 on RCSB PDB site
Description: Chalcone synthase from Malus domestica
Class: transferase
Keywords: transferase, thiolase, polyketide
Deposited on 2016-12-21, released 2017-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CHS2 chalcone synthase
    Species: Malus domestica [TaxId:3750]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uc5a1, d5uc5a2
  • Chain 'B':
    Compound: CHS2 chalcone synthase
    Species: Malus domestica [TaxId:3750]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5uc5b1, d5uc5b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uc5A (A:)
    gsmvtveevrkaqraegpatvlaigtatpsncvdqatypdyyfritnsehktelkekfqr
    mcdksmikkrymylteeilkenptvceymapsldarqdmvvvevprlgkeaatkaikewg
    qpkskithlvfcttsgvdmpgadyqltkllglrpyvkrlmmyqqgcfaggtvlrlakdla
    ennkgarvlvvcseitavtfrgpsdthldslvgqalfgdgaaaviigadplpevekplfe
    lvsaaqtilpdsdgaidghlrevgltfhllkdvpgliskniekslneafkpigisdwnsl
    fwiahpggpaildqvesklalkpekleatrqvlsnygnmssacvlfildevrrkstekgl
    rttgeglewgvlfgfgpgltvetvvlhsva
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uc5A (A:)
    vtveevrkaqraegpatvlaigtatpsncvdqatypdyyfritnsehktelkekfqrmcd
    ksmikkrymylteeilkenptvceymapsldarqdmvvvevprlgkeaatkaikewgqpk
    skithlvfcttsgvdmpgadyqltkllglrpyvkrlmmyqqgcfaggtvlrlakdlaenn
    kgarvlvvcseitavtfrgpsdthldslvgqalfgdgaaaviigadplpevekplfelvs
    aaqtilpdsdgaidghlrevgltfhllkdvpgliskniekslneafkpigisdwnslfwi
    ahpggpaildqvesklalkpekleatrqvlsnygnmssacvlfildevrrkstekglrtt
    geglewgvlfgfgpgltvetvvlhsva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5uc5B (B:)
    gsmvtveevrkaqraegpatvlaigtatpsncvdqatypdyyfritnsehktelkekfqr
    mcdksmikkrymylteeilkenptvceymapsldarqdmvvvevprlgkeaatkaikewg
    qpkskithlvfcttsgvdmpgadyqltkllglrpyvkrlmmyqqgcfaggtvlrlakdla
    ennkgarvlvvcseitavtfrgpsdthldslvgqalfgdgaaaviigadplpevekplfe
    lvsaaqtilpdsdgaidghlrevgltfhllkdvpgliskniekslneafkpigisdwnsl
    fwiahpggpaildqvesklalkpekleatrqvlsnygnmssacvlfildevrrkstekgl
    rttgeglewgvlfgfgpgltvetvvlhsva
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uc5B (B:)
    vtveevrkaqraegpatvlaigtatpsncvdqatypdyyfritnsehktelkekfqrmcd
    ksmikkrymylteeilkenptvceymapsldarqdmvvvevprlgkeaatkaikewgqpk
    skithlvfcttsgvdmpgadyqltkllglrpyvkrlmmyqqgcfaggtvlrlakdlaenn
    kgarvlvvcseitavtfrgpsdthldslvgqalfgdgaaaviigadplpevekplfelvs
    aaqtilpdsdgaidghlrevgltfhllkdvpgliskniekslneafkpigisdwnslfwi
    ahpggpaildqvesklalkpekleatrqvlsnygnmssacvlfildevrrkstekglrtt
    geglewgvlfgfgpgltvetvvlhsva