PDB entry 5ubs

View 5ubs on RCSB PDB site
Description: Solution NMR Structure of NERD-S, a natively folded pentamutant of the B1 domain of streptococcal protein G (GB1) with a solvent-exposed Trp43
Class: de novo protein
Keywords: dynamics, computational design, conformational exchange, immunoglobulin-binding, DE NOVO PROTEIN
Deposited on 2016-12-21, released 2017-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. GX7805 [TaxId:1325]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (1-55)
      • initiating methionine (0)
      • engineered mutation (2)
      • engineered mutation (5)
      • engineered mutation (33)
      • engineered mutation (38)
      • engineered mutation (53)
    Domains in SCOPe 2.08: d5ubsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ubsA (A:)
    mtfkliingktlkgettteavdaataekvfkqyfndngidgewtyddatktftite