PDB entry 5uad

View 5uad on RCSB PDB site
Description: MET Tyrosine Kinase Inhibition Enhances the Antitumor Efficacy of an HGF Antibody
Class: transferase/inhibitor
Keywords: MET, Tyrosine Kinase, Inhibitor, Antitumor, TRANSFERASE-INHIBITOR complex
Deposited on 2016-12-19, released 2017-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5uada_
  • Heterogens: 84P, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5uadA (A:)
    gamgsqvqypltdmspiltsgdsdisspllqntvhidlsalnpelvqavqhvvigpssli
    vhfnevigrghfgcvyhgtlldndgkkihcavkslnritdigevsqfltegiimkdfshp
    nvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvkdligfglqvakgmkylas
    kkfvhrdlaarncmldekftvkvadfglardmydkeyysvhnktgaklpvkwmaleslqt
    qkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevml
    kcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5uadA (A:)
    tdmspinpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlhcavkslnigevsqf
    ltegiimkdfshpnvlsllgiclplvvlpymkhgdlrnfirnethnptvkdligfglqva
    kgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhnktgaklpvkw
    maleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycp
    dplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvhvnatyvnvk