PDB entry 5u9m

View 5u9m on RCSB PDB site
Description: Copper-Zinc Superoxide Dismutase is Activated through a Sulfenic Acid Intermediate at a Copper-ion Entry Site
Class: oxidoreductase/chaperone
Keywords: oxidoreductase-chaperone complex, Cu-Zn superoxide dismutase, metallochaperone
Deposited on 2016-12-16, released 2017-05-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-31, with a file datestamp of 2017-05-26.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (45)
      • engineered mutation (47)
    Domains in SCOPe 2.06: d5u9ma_
  • Chain 'B':
    Compound: superoxide dismutase 1 copper chaperone
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CCS1, LYS7, YMR038C, YM9532.03C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40202
      • engineered mutation (236-238)
    Domains in SCOPe 2.06: d5u9mb1, d5u9mb2
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (45)
      • engineered mutation (47)
    Domains in SCOPe 2.06: d5u9mc_
  • Chain 'D':
    Compound: superoxide dismutase 1 copper chaperone
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CCS1, LYS7, YMR038C, YM9532.03C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40202
      • engineered mutation (236-238)
    Domains in SCOPe 2.06: d5u9md1, d5u9md2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5u9mA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u9mB (B:)
    ttndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintl
    rncgkdaiirgagkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvn
    gvpeagnyhasihekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplp
    twqligrsfviskslnhpenepssvkdysflgviarsagvwennkqvcactgktvwaaak
    dalannik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u9mB (B:)
    eatyaicencvndikaclknvpginslnfdieqqimsvessvapstiintldaiirgagk
    pnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasihe
    kgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvisks
    lnhpenepssvkdysflgviarsagvwennkqvcactgktvwaaak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5u9mC (C:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u9mD (D:)
    ttndtyeatyaipmhcencvndikaclknvpginslnfdieqqimsvessvapstiintl
    rncgkdaiirgagkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvn
    gvpeagnyhasihekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplp
    twqligrsfviskslnhpenepssvkdysflgviarsagvwennkqvcactgktvwaaak
    dalannik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u9mD (D:)
    tyeatyaipcencvndikaclknvpginslnfdieqqimsvessvapstiintlrncgkd
    aiirgagkpnssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeag
    nyhasihekgdvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqlig
    rsfviskslnhpenepssvkdysflgviarsagvwennkqvcactgktvwaaak