PDB entry 5u92

View 5u92 on RCSB PDB site
Description: Crystal Structure of arginine kinase from the spider Polybetes pythagoricus in complex with arginine
Class: transferase
Keywords: arginine kinase, binary complex, spider, Polybetes pythagoricus, phosphagen metabolism, TRANSFERASE
Deposited on 2016-12-15, released 2017-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Polybetes pythagoricus [TaxId:881871]
    Database cross-references and differences (RAF-indexed):
    • PDB 5U92 (Start-383)
    Domains in SCOPe 2.08: d5u92a1, d5u92a2
  • Heterogens: ARG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u92A (A:)
    mgshhhhhhhhhhssghlevlfqgpshmvdqatldkleagfkklqdatdcksllkkylnr
    evfdqckslktalgatlldciqsgvenldsgvgiyapdaeaytlfapifnpiiedyhegf
    kptdkhpptdfgdintivnvdpsgkyvvsthvrcgrslkgypfnpclteanykemedkvs
    aifgtfegelkgkyypltgmdkatqqqliddhflfkegdrflqaanacrywptgrgiyhn
    daktflvwvneedhlriismqkggdlktifqrlvnavntiesklpfsrddrlgfltfcpt
    nlgttirasvhialpklakdkkqleaiaakfnlqvrgtrgehteseggvydisnkrrmgl
    teyqavkemqdgilemikmeeaap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u92A (A:)
    mvdqatldkleagfkklqdatdcksllkkylnrevfdqckslktalgatlldciqsgven
    ldsgvgiyapdaeaytlfapifnpiiedyhegfkptdkhpptdfgdintivnvdpsgkyv
    vsthvrcgrslkgypfnpclteanykemedkvsaifgtfegelkgkyypltgmdkatqqq
    liddhflfkegdrflqaanacrywptgrgiyhndaktflvwvneedhlriismqkggdlk
    tifqrlvnavntiesklpfsrddrlgfltfcptnlgttirasvhialpklakdkkqleai
    aakfnlqvrggvydisnkrrmglteyqavkemqdgilemikmeeaap