PDB entry 5u8e

View 5u8e on RCSB PDB site
Description: Crystal Structure of substrate-free arginine kinase from spider Polybetes pythagoricus
Class: transferase
Keywords: phosphagen metabolism, arginine kinase, spider, open conformation, free-ligand, TRANSFERASE
Deposited on 2016-12-14, released 2017-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Polybetes pythagoricus [TaxId:881871]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5U8E (Start-383)
    Domains in SCOPe 2.06: d5u8ea1, d5u8ea2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u8eA (A:)
    mgshhhhhhhhhhssghlevlfqgpshmvdqatldkleagfkklqdatdcksllkkylnr
    evfdqckslktalgatlldciqsgvenldsgvgiyapdaeaytlfapifnpiiedyhegf
    kptdkhpptdfgdintivnvdpsgkyvvsthvrcgrslkgypfnpclteanykemedkvs
    aifgtfegelkgkyypltgmdkatqqqliddhflfkegdrflqaanacrywptgrgiyhn
    daktflvwvneedhlriismqkggdlktifqrlvnavntiesklpfsrddrlgfltfcpt
    nlgttirasvhialpklakdkkqleaiaakfnlqvrgtrgehteseggvydisnkrrmgl
    teyqavkemqdgilemikmeeaap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u8eA (A:)
    mvdqatldkleagfkklqdatdcksllkkylnrevfdqckslktalgatlldciqsgven
    ldsgvgiyapdaeaytlfapifnpiiedyhegfkptdkhpptdfgdintivnvdpsgkyv
    vsthvrcgrslkgypfnpclteanykemedkvsaifgtfegelkgkyypltgmdkatqqq
    liddhflfkegdrflqaanacrywptgrgiyhndaktflvwvneedhlriismqkggdlk
    tifqrlvnavntiesklpfsrddrlgfltfcptnlgttirasvhialpklakdkkqleai
    aakfnlqvrggvydisnkrrmglteyqavkemqdgilemikmeeaap