PDB entry 5u89

View 5u89 on RCSB PDB site
Description: Crystal structure of a cross-module fragment from the dimodular NRPS DhbF
Class: hydrolase/inhibitor
Keywords: nonribosomal peptide synthetase, MbtH-like protein, mechanism-based inhibitor, megaenzyme, HYDROLASE-INHIBITOR complex
Deposited on 2016-12-14, released 2017-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 3.08 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amino acid adenylation domain protein
    Species: Geobacillus sp. [TaxId:581103]
    Gene: GY4MC1_0171
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0F6BHX2 (Start-1070)
      • expression tag (1071-1078)
  • Chain 'B':
    Compound: MbtH domain protein
    Species: Geobacillus sp. [TaxId:581103]
    Gene: GY4MC1_0172
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u89b_
  • Heterogens: MJ8

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5u89B (B:)
gamgmtnpfenkegtylvlindegqyslwpasiaippgwniafaentrsacldyinahwi
dmrpnslkdgslskrdndysgvk

    Sequence, based on observed residues (ATOM records): (download) 
    >5u89B (B:)
tnpfenkegtylvlindegqyslwpasiaippgwniafaentrsacldyinahwidmrpn
slkd