PDB entry 5u86

View 5u86 on RCSB PDB site
Description: Structure of the Aquifex aeolicus LpxC/LPC-069 complex
Class: hydrolase/hydrolase inhibitor
Keywords: LpxC lipid A antibiotic LPS, hydrolase-hydrolase inhibitor complex
Deposited on 2016-12-13, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-3-O-acyl-N-acetylglucosamine deacetylase
    Species: Aquifex aeolicus (strain VF5) [TaxId:224324]
    Gene: lpxC, envA, aq_1772
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67648
      • engineered mutation (180)
    Domains in SCOPe 2.07: d5u86a1, d5u86a2
  • Heterogens: ZN, 81V, CL, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u86A (A:)
    mglektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhst
    dlgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnre
    idyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartf
    afdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgs
    pvkgkfysfrgghslnvklvkelakkqkltrdlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u86A (A:)
    glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
    lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
    dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
    fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
    vkgkfysfrgghslnvklvkelakkqklt