PDB entry 5u5w

View 5u5w on RCSB PDB site
Description: CcP gateless cavity
Class: oxidoreductase
Keywords: Model system, Cytochrome c Peroxidase, GIST, water, desolvation, docking, ligand binding, OXIDOREDUCTASE
Deposited on 2016-12-07, released 2017-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase
    Species: Saccharomyces cerevisiae (strain RM11-1a) [TaxId:285006]
    Gene: SCRG_04081
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3LRE1 (0-288)
      • engineered mutation (186-187)
    Domains in SCOPe 2.07: d5u5wa_
  • Heterogens: HEM, 7W1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5u5wA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
    sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl