PDB entry 5u5l

View 5u5l on RCSB PDB site
Description: X-ray Crystal Structure of the PPARgamma Ligand Binding Domain in Complex with Rivoglitazone
Class: transcription/inhibitor
Keywords: Nuclear Receptor, Peroxisome Proliferator Activated Receptor, rivoglitazone, TZD, TRANSCRIPTION-INHIBITOR complex
Deposited on 2016-12-06, released 2017-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u5la_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u5lb_
  • Heterogens: 7VA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u5lA (A:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikf
    khitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhe
    iiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdl
    aifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrq
    ivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u5lA (A:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkiev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u5lB (B:)
    npesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikf
    khitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhe
    iiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdl
    aifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrq
    ivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u5lB (B:)
    esadlralakhlydsyiksfpltkakarailtgkspfviydmnslmmgedkikfkhitev
    airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetpllqeiykdl