PDB entry 5u51

View 5u51 on RCSB PDB site
Description: Structure of Francisella tularensis heterodimeric SspA (MglA-SspA) in complex with ppGpp
Class: transcription
Keywords: Stringent starvation protein A, Macrophage growth locus A, ppGpp, GST-fold, TRANSCRIPTION
Deposited on 2016-12-06, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage growth locus A
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Gene: DR86_1530
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Macrophage growth locus A
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Gene: DR86_1530
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: stringent starvation protein A
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Gene: DR86_1150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u51c1, d5u51c2, d5u51c3
  • Chain 'D':
    Compound: stringent starvation protein A
    Species: FRANCISELLA TULARENSIS [TaxId:263]
    Gene: DR86_1150
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u51d1, d5u51d2, d5u51d3
  • Heterogens: GOL, 1PE, MG, G4P, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u51C (C:)
    snamvtlyttkycpyslrarialaekkmstdiveagdlepamikkitpngvfpvlmekdy
    sinnrkalliyiderfpapsllpnvvnerikirlsldkidnewypvldqirkhrsdqkml
    esmfkdlkesllamekaftgseffissgftladcyiaaliicleaegfiiddeygaiyey
    kkrlfardsvkkanikggagesllktlrthr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u51C (C:)
    snamvtlyttkycpyslrarialaekkmstdiveagdlepamikkitpngvfpvlmekdy
    sinnrkalliyiderfpapsllpnvvnerikirlsldkidnewypvldqirkhrsdqkml
    esmfkdlkesllamekaftgseffissgftladcyiaaliicleaegfiiddeygaiyey
    kkrlfardsvkkani
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u51D (D:)
    snamvtlyttkycpyslrarialaekkmstdiveagdlepamikkitpngvfpvlmekdy
    sinnrkalliyiderfpapsllpnvvnerikirlsldkidnewypvldqirkhrsdqkml
    esmfkdlkesllamekaftgseffissgftladcyiaaliicleaegfiiddeygaiyey
    kkrlfardsvkkanikggagesllktlrthr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u51D (D:)
    namvtlyttkycpyslrarialaekkmstdiveagdlepamikkitpngvfpvlmekdys
    innrkalliyiderfpapsllpnvvnerikirlsldkidnewypvldqirkhrsdqkmle
    smfkdlkesllamekaftgseffissgftladcyiaaliicleaegfiiddeygaiyeyk
    krlfardsvkkani