PDB entry 5u4f

View 5u4f on RCSB PDB site
Description: Wild-type Transthyretin in complex with 1,1'-(1E)-(1,2-Ethenediyl)bis[2-chloro-4-boronic acid]benzene
Class: transport protein
Keywords: Boronic acids, Medicinal chemistry, stilbene, covalent ligand, TRANSPORT PROTEIN
Deposited on 2016-12-03, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u4fa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u4fb_
  • Heterogens: IWW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u4fA (A:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u4fA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u4fB (B:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u4fB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn