PDB entry 5u49

View 5u49 on RCSB PDB site
Description: Wild-type Transthyretin in complex with 5-[(1E)-2-(2-Chloro-4-hydroxyphenyl)ethenyl]-1,3-benzenediol
Class: transport protein
Keywords: Boronic acids, Medicinal chemistry, stilbene, covalent ligand, TRANSPORT PROTEIN
Deposited on 2016-12-03, released 2017-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5u49a_
  • Heterogens: S2L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u49A (A:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u49A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp