PDB entry 5u3a

View 5u3a on RCSB PDB site
Description: Ultra High Resolution Crystal Structure of Human Pancreatic Alpha Amylase
Class: hydrolase
Keywords: Amylase, Diabetes, Obesity, Glucosyl hydrolase, HYDROLASE
Deposited on 2016-12-01, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: N/A
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pancreatic alpha-amylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AMY2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u3aa1, d5u3aa2
  • Heterogens: NAG, CL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5u3aA (A:)
    eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
    eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
    pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl