PDB entry 5u2w

View 5u2w on RCSB PDB site
Description: Crystal structure of a Short chain dehydrogenase from Burkholderia cenocepacia J2315 in complex with NADP
Class: oxidoreductase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE
Deposited on 2016-12-01, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short chain dehydrogenase
    Species: Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) [TaxId:216591]
    Gene: BCAL2464
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u2wa_
  • Chain 'B':
    Compound: Short chain dehydrogenase
    Species: Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) [TaxId:216591]
    Gene: BCAL2464
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u2wb_
  • Chain 'C':
    Compound: Short chain dehydrogenase
    Species: Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) [TaxId:216591]
    Gene: BCAL2464
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u2wc_
  • Chain 'D':
    Compound: Short chain dehydrogenase
    Species: Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) [TaxId:216591]
    Gene: BCAL2464
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u2wd_
  • Heterogens: NAP, EDO, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u2wA (A:)
    mahhhhhhmnrlqgkralvtggsrgigaaiakrlaadgadvaityeksaeraqavvagie
    algrraiaiqadsadpvavrnavdrvaeafggldilvnnagifragslddltlddidatl
    nvnvravivasqaaarhlgeggrivstgsclatrvpdagmslyaaskaaligwtqglard
    lgprgitvnivhpgstdtdmnpadgahadaqrsrmaiqqygkaddvaalvafvvgpegrs
    ingtgltidggana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u2wA (A:)
    mnrlqgkralvtggsrgigaaiakrlaadgadvaityeksaeraqavvagiealgrraia
    iqadsadpvavrnavdrvaeafggldilvnnagifragslddltlddidatlnvnvravi
    vasqaaarhlgeggrivstgsclatrvpdagmslyaaskaaligwtqglardlgprgitv
    nivhpgstdtdmnpadgahadaqrsrmaiqqygkaddvaalvafvvgpegrsingtglti
    dggana
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u2wB (B:)
    mahhhhhhmnrlqgkralvtggsrgigaaiakrlaadgadvaityeksaeraqavvagie
    algrraiaiqadsadpvavrnavdrvaeafggldilvnnagifragslddltlddidatl
    nvnvravivasqaaarhlgeggrivstgsclatrvpdagmslyaaskaaligwtqglard
    lgprgitvnivhpgstdtdmnpadgahadaqrsrmaiqqygkaddvaalvafvvgpegrs
    ingtgltidggana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u2wB (B:)
    nrlqgkralvtggsrgigaaiakrlaadgadvaityeksaeraqavvagiealgrraiai
    qadsadpvavrnavdrvaeafggldilvnnagifragslddltlddidatlnvnvraviv
    asqaaarhlgeggrivstgsclatrvpdagmslyaaskaaligwtqglardlgprgitvn
    ivhpgstdtdmnpadgahadaqrsrmaiqqygkaddvaalvafvvgpegrsingtgltid
    ggana
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u2wC (C:)
    mahhhhhhmnrlqgkralvtggsrgigaaiakrlaadgadvaityeksaeraqavvagie
    algrraiaiqadsadpvavrnavdrvaeafggldilvnnagifragslddltlddidatl
    nvnvravivasqaaarhlgeggrivstgsclatrvpdagmslyaaskaaligwtqglard
    lgprgitvnivhpgstdtdmnpadgahadaqrsrmaiqqygkaddvaalvafvvgpegrs
    ingtgltidggana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u2wC (C:)
    nrlqgkralvtggsrgigaaiakrlaadgadvaityeksaeraqavvagiealgrraiai
    qadsadpvavrnavdrvaeafggldilvnnagifragslddltlddidatlnvnvraviv
    asqaaarhlgeggrivstgsclatrvpdagmslyaaskaaligwtqglardlgprgitvn
    ivhpgstdtdmnpadgahadaqrsrmaiqqygkaddvaalvafvvgpegrsingtgltid
    ggana
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u2wD (D:)
    mahhhhhhmnrlqgkralvtggsrgigaaiakrlaadgadvaityeksaeraqavvagie
    algrraiaiqadsadpvavrnavdrvaeafggldilvnnagifragslddltlddidatl
    nvnvravivasqaaarhlgeggrivstgsclatrvpdagmslyaaskaaligwtqglard
    lgprgitvnivhpgstdtdmnpadgahadaqrsrmaiqqygkaddvaalvafvvgpegrs
    ingtgltidggana
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u2wD (D:)
    nrlqgkralvtggsrgigaaiakrlaadgadvaityeksaeraqavvagiealgrraiai
    qadsadpvavrnavdrvaeafggldilvnnagifragslddltlddidatlnvnvraviv
    asqaaarhlgeggrivstgsclatrvpdagmslyaaskaaligwtqglardlgprgitvn
    ivhpgstdtdmnpadgahadaqrsrmaiqqygkaddvaalvafvvgpegrsingtgltid
    ggana