PDB entry 5u2k

View 5u2k on RCSB PDB site
Description: Crystal structure of Galactoside O-acetyltransferase complex with CoA (H3 space group)
Class: transferase
Keywords: CSGID, Galactoside O-acetyltransferase, CoA, Structural Genomics, Center for Structural Genomics of Infectious Diseases, TRANSFERASE
Deposited on 2016-11-30, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactoside o-acetyltransferase
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: SACOL2570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u2ka_
  • Heterogens: EDO, CL, PO4, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u2kA (A:)
    mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
    vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
    rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
    vrkidndlpsetlndetik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u2kA (A:)
    mtekekmlaekwydanfdqylinerarakdicfelnhtrpsatnkrkelidqlfqtttdn
    vsisipfdtdygwnvklgknvyvntncyfmdggqitigdnvfigpncgfytathplnfhh
    rnegfekagpihigsntwfgghvavlpgvtigegsvigagsvvtkdipphslavgnpckv
    vrkidndlps