PDB entry 5u26

View 5u26 on RCSB PDB site
Description: Crystal Structure of Mycobacterium tuberculosis Dihydrofolate Reductase Bound to NADP and p218 Inhibitor
Class: oxidoreductase
Keywords: DHFR, Folate, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE
Deposited on 2016-11-29, released 2016-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: folA, folA_1, BN1213_03327, BN1303_00864, ERS007661_02580, ERS007663_03946, ERS007665_02766, ERS007741_00337, ERS013471_00736, ERS023446_01268, ERS024213_02711, ERS027644_04978, ERS027646_03318, ERS027653_04780, ERS027654_00299, ERS027656_00246, ERS027659_04151, ERS027661_03595, ERS027666_04095, ERS031537_04020, ERS124361_01473, RN05_2938
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E8UVJ4 (20-178)
      • expression tag (13-19)
    Domains in SCOPe 2.08: d5u26a1, d5u26a2
  • Heterogens: MMV, NAP, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u26A (A:)
    mgsshhhhhhssglvprgshmvgliwaqatsgvigrggdipwrlpedqahfreitmghti
    vmgrrtwdslpakvrplpgrrnvvlsrqadfmasgaevvgsleealtspetwvigggqvy
    alalpyatrcevtevdiglpreagdalapvldetwrgetgewrfsrsglryrlysyhrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u26A (A:)
    lvprgshmvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpak
    vrplpgrrnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevt
    evdiglpreagdalapvldetwrgetgewrfsrsglryrlysyhrs