PDB entry 5u23

View 5u23 on RCSB PDB site
Description: X-ray structure of the WlaRG aminotransferase from Campylobacter jejuni in complex with TDP-Qui3N
Class: transferase
Keywords: aminotransferase lipooligosaccharide pyridoxal 5'-phosphate, TRANSFERASE
Deposited on 2016-11-29, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
    Domains in SCOPe 2.07: d5u23a1, d5u23a2
  • Chain 'B':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (15-16)
      • expression tag (21)
  • Chain 'C':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
    Domains in SCOPe 2.07: d5u23c1, d5u23c2
  • Chain 'D':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (13-16)
      • expression tag (20-21)
  • Heterogens: NA, TQP, EDO, CL, MPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u23A (A:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u23A (A:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u23C (C:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u23C (C:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'D':
    No sequence available.