PDB entry 5u21

View 5u21 on RCSB PDB site
Description: X-ray structure of the WlaRF aminotransferase from Campylobacter jejuni, K184A mutant in complex with TDP-Qui3N
Class: Transferase
Keywords: aminotransferase, pyridoxal 5'-phosphate, lipooligosaccharide, Transferase
Deposited on 2016-11-29, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
      • engineered mutation (205)
    Domains in SCOPe 2.06: d5u21a1, d5u21a2
  • Chain 'B':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (20-21)
      • engineered mutation (205)
    Domains in SCOPe 2.06: d5u21b1, d5u21b2
  • Chain 'C':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
      • engineered mutation (205)
    Domains in SCOPe 2.06: d5u21c1, d5u21c2
  • Chain 'D':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
      • engineered mutation (205)
    Domains in SCOPe 2.06: d5u21d1, d5u21d2
  • Heterogens: NA, TQP, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u21A (A:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypganlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u21A (A:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypganlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u21B (B:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypganlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u21B (B:)
    ghmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvang
    ldalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieek
    itkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagf
    sfypganlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafld
    iklkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnh
    diqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkw
    kv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u21C (C:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypganlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u21C (C:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypganlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u21D (D:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypganlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u21D (D:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypganlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v