PDB entry 5u1z

View 5u1z on RCSB PDB site
Description: X-ray structure of the WlarG aminotransferase, apo form, from Campylobacter jejune
Class: transferase
Keywords: aminotransferase, PLP, lipooligosaccharide, TRANSFERASE
Deposited on 2016-11-29, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
    Domains in SCOPe 2.07: d5u1za1, d5u1za2
  • Chain 'B':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
    Domains in SCOPe 2.07: d5u1zb1, d5u1zb2
  • Chain 'C':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ALS9 (22-381)
      • expression tag (21)
    Domains in SCOPe 2.07: d5u1zc1, d5u1zc2
  • Chain 'D':
    Compound: Putative aminotransferase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5u1zd_
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u1zA (A:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1zA (A:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u1zB (B:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1zB (B:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5u1zC (C:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1zC (C:)
    hmfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangl
    dalrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieeki
    tkktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfs
    fypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldi
    klkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhd
    iqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk
    v
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5u1zD (D:)
    mgsshhhhhhssrnlyfqggghmfflnlkqindrfntefitkfkeilesgwyilgkqcek
    fennfakycgvkhcigvangldalrliikaydfkendeiivpantyiasilaitdnkckp
    iliepdintyninpdlieekitkktkaimvvhlygqvcdmekiqllankynlkiiedcaq
    ahgaiykdkrvgnlgdaagfsfypgknlgalgdagcictnddnfaskiralanygshkky
    enlytglnsrldeiqaafldiklkyldednnkrknianfylqnikneniilpsnkfdhvw
    hlfvvktklrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslp
    isptmkendfkkvadilnkwkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u1zD (D:)
    mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangld
    alrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieekit
    kktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfsf
    ypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldik
    lkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhdi
    qtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwk