PDB entry 5u0y

View 5u0y on RCSB PDB site
Description: E. coli dihydropteroate synthase complexed with an 8-mercaptoguanine derivative: [(2-amino-6-oxo-6,9-dihydro-1H-purin-8-yl)sulfanyl]acetic acid
Class: transferase/transferase inhibitor
Keywords: E. coli, DHPS, complex, pterin site, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-11-27, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
    Gene: folP, c3933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5u0ya_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) [TaxId:199310]
    Gene: folP, c3933
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AC14 (2-283)
      • expression tag (1)
    Domains in SCOPe 2.06: d5u0yb1, d5u0yb2
  • Heterogens: 7PJ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5u0yA (A:)
    gsmklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvg
    gestrpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindir
    slsepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagia
    kekllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsg
    slacaviaamqgahiirvhdvketveamrvveatlsakenkrye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u0yA (A:)
    mklfaqgtsldlshphvmgilnvtpnslidavkhanlminagatiidvggestrpgaaev
    sveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirslsepgaleaa
    aetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagiakekllldpgfg
    fgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgslacaviaamq
    gahiirvhdvketveamrvveatlsakenkrye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5u0yB (B:)
    gsmklfaqgtsldlshphvmgilnvtpdsfsdggthnslidavkhanlminagatiidvg
    gestrpgaaevsveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindir
    slsepgaleaaaetglpvclmhmqgnpktmqeapkyddvfaevnryfieqiarceqagia
    kekllldpgfgfgknlshnysllarlaefhhfnlpllvgmsrksmigqllnvgpserlsg
    slacaviaamqgahiirvhdvketveamrvveatlsakenkrye
    

    Sequence, based on observed residues (ATOM records): (download)
    >5u0yB (B:)
    smklfaqgtsldlshphvmgilnvtnslidavkhanlminagatiidvggestrpgaaev
    sveeelqrvipvveaiaqrfevwisvdtskpeviresakvgahiindirslsepgaleaa
    aetglpvclmhmqpkyddvfaevnryfieqiarceqagiakekllldpgfgfgknlshny
    sllarlaefhhfnlpllvgmsrksmigqllnvgpserlsgslacaviaamqgahiirvhd
    vketveamrvveatlsakenkrye