PDB entry 5tzn

View 5tzn on RCSB PDB site
Description: Structure of the viral immunoevasin m12 (Smith) bound to the natural killer cell receptor NKR-P1B (B6)
Class: immune system/viral protein
Keywords: C-type lectin-like domain, immonoglobulin like domain, CELL INVASION, IMMUNE SYSTEM-VIRAL PROTEIN complex
Deposited on 2016-11-22, released 2017-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4 (Start-128)
      • engineered mutation (31)
      • expression tag (129-130)
    Domains in SCOPe 2.07: d5tzna1, d5tzna2
  • Chain 'F':
    Compound: Glycoprotein family protein m12
    Species: Murid herpesvirus 1 [TaxId:10366]
    Gene: m12
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Glycoprotein family protein m12
    Species: Murid herpesvirus 1 [TaxId:10366]
    Gene: m12
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Killer cell lectin-like receptor subfamily B member 1B allele B
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1b, Klrb1d, Ly55d, Nkrp1b, Nkrp1d
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99JB4 (Start-128)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d5tznw_
  • Heterogens: NAG, IOD, FUC, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5tznA (A:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tznA (A:)
    klecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsiekyns
    fwiglsytltdmnwkwingtafnslkitgvtengscaaisgekvtsegcssdnrwicqke
    lngt
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5tznW (W:)
    tgsaklecpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsik
    ekynsfwiglsytltdmnwkwingtafnsdvlkitgvtengscaaisgekvtsegcssdn
    rwicqkelngthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tznW (W:)
    cpqdwlshrdkcfhvsqvsntwkegridcdkkgatllliqdqeelrflldsiekynsfwi
    glsytltdmnwkwingtafnsvlkitgvtengscaaisgekvtsegcssdnrwicqkeln